Monoamine Oxidase A/MAOA Antibody

• Catalog Number: orb315172
• Category: Antibodies
• Description: Monoamine Oxidase A/MAOA Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 59682 MW
• UniProt ID: P21397
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Amine oxidase [flavin-containing] A;1.4.3.4;Monoam
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U87 cells using anti-MAOA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of U20S cells using anti-MAOA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of MAOA using anti-MAOA antibody.Lane 1:human RT4 cell;2:human HepG2 cell;3:rat liver tissue;4:mouse liver tissue.

IF analysis of MAOA using anti-MAOA antibody. MAOA was detected in immunocytochemical section of U20S cells.

IHC analysis of MAOA using anti-MAOA antibody. MAOA was detected in a paraffin-embedded section of mouse cardiac muscle tissue.

IHC analysis of MAOA using anti-MAOA antibody. MAOA was detected in a paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of MAOA using anti-MAOA antibody. MAOA was detected in a paraffin-embedded section of rat cardiac muscle tissue.