You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316590 |
---|---|
Category | Antibodies |
Description | MMP8 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA, IHC, WB |
Reactivity | Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat ELISA , 0.1-0.5μg/ml, Mouse, -Western blot, 0.1-0.5μg/ml, Mouse, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 53126 MW |
UniProt ID | O70138 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Neutrophil collagenase;3.4.24.34;Collagenase 2;Mat Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of MMP8 using anti-MMP8 antibody.Lane 1:Mouse Testis Tissue;2:NIH3T3 Cell;3:HEPA Cell;4:NRK Cell.
IHC analysis of MMP8 using anti-MMP8 antibody. MMP8 was detected in paraffin-embedded section of Mouse Spleen Tissue.
IHC analysis of MMP8 using anti-MMP8 antibody. MMP8 was detected in paraffin-embedded section of Rat Spleen Tissue.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating