MMP8 Antibody

• Catalog Number: orb316589
• Category: Antibodies
• Description: MMP8 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP-8 (119-153aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ), different from the related mouse sequence by eleven amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat ELISA , 0.1-0.5μg/ml, Human, -Western blot, 0.1-0.5μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 53412 MW
• UniProt ID: P22894
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Neutrophil collagenase;3.4.24.34;Matrix metallopro
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of MMP8 using anti-MMP8 antibody.Lane 1:K562 Cell;2:JURKAT Cell.

IHC analysis of MMP8 using anti-MMP8 antibody. MMP8 was detected in paraffin-embedded section of Human Appendicitis Tissue.