Mkx Rabbit Polyclonal Antibody

SKU: orb576342

Description

Mkx Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Mkx. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mkx. This antibody reacts with Mouse samples and is predicted to react with Mouse. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Mouse

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mkx
• Target: Mkx
• Protein Sequence: Synthetic peptide located within the following region: SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW
• Molecular Weight: 38kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Ir, Irxl1, 9430023B20Rik

Quick Database Links

Gene Symbol

Mkx

UniProt

Q8BIA3

RefSeq (Protein):NP_808263