You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290713 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant MGC21874. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 1C8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | XP_291105 |
Detection limit for recombinant GST tagged MGC21874 is approximately 0.3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
MGC21874 monoclonal antibody (M08), clone 1C8 Western Blot analysis of MGC21874 expression in HeLa.
MGC21874 monoclonal antibody (M08), clone 1C8. Western Blot analysis of MGC21874 expression in NIH/3T3.
MGC21874 monoclonal antibody (M08), clone 1C8. Western Blot analysis of MGC21874 expression in PC-12.
MGC21874 monoclonal antibody (M08), clone 1C8. Western Blot analysis of MGC21874 expression in Raw 264.7.
Western Blot detection against Immunogen (37.73 KDa).