MGAT4B monoclonal antibody (M01), clone 1F4

• Catalog Number: orb2291408
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MGAT4B.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: MGAT4B (NP_055090, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: AEVSTSLKTYQHFTLEKAYLREDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTATLRYPRSPDGY
• Tested applications: ELISA, IF, WB
• Clone Number: 1F4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_055090

Immunofluorescence of monoclonal antibody to MGAT4B on HeLa cell. [antibody concentration 10 ug/ml]

MGAT4B monoclonal antibody (M01), clone 1F4. Western Blot analysis of MGAT4B expression in human pancreas.