You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291657 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant MFN2.This product is belong to Cell Culture Grade Antibody (CX Grade). |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | MFN2 (NP_055689, 661 a.a. ~ 757 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 4H8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_055689 |
Detection limit for recombinant GST tagged MFN2 is approximately 1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5 ug/ml]
Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03A), clone 4H8. Lane 1: MFN2 transfected lysate (86.4 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody (M03), clone 4H8. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (36.41 KDa).