MFN2 monoclonal antibody (M03J), clone 4H8

• Catalog Number: orb2291657
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant MFN2.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: MFN2 (NP_055689, 661 a.a. ~ 757 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 4H8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_055689

Detection limit for recombinant GST tagged MFN2 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5 ug/ml]

Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03A), clone 4H8. Lane 1: MFN2 transfected lysate (86.4 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody (M03), clone 4H8. GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.41 KDa).