You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334495 |
---|---|
Category | Antibodies |
Description | MEK3/MAP2K3 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, By Heat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 39318 MW |
UniProt ID | P46734 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Dual specificity mitogen-activated protein kinase Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of CACO-2 cells using anti-MEK3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.
WB analysis of MEK3 using anti-MEK3 antibody.Lane 1:human HeLa cell;2:rat kidney tissue;3:mouse NIH/3T3 cell.
IF analysis of MEK3 using anti-MEK3 antibody. MEK3 was detected in an immunocytochemical section of CACO-2 cells.
IHC analysis of MEK3 using anti-MEK3 antibody. MEK3 was detected in a paraffin-embedded section of human liver cancer tissue.
IHC analysis of MEK3 using anti-MEK3 antibody. MEK3 was detected in a paraffin-embedded section of human ovarian cancer tissue.
FC, ICC, IF, IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IF, IHC, WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC, WB | |
Canine, Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating