MEF2C Antibody

• Catalog Number: orb443200
• Category: Antibodies
• Description: MEF2C Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 50-65 kDa
• UniProt ID: Q06413
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Myocyte-specific enhancer factor 2C ; Myocyte enha
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HELA cells using anti-MEF2C antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of MEF2C using anti-MEF2C antibody.Lane 1:human K562 cell; 2:human COLO320 cell; 3:human DAUDI cell; 4:human U937 cell; 5:rat brain tissue.

IHC analysis of MEF2C using anti-MEF2C antibody. MEF2C was detected in paraffin-embedded section of human tonsil tissue.

IHC analysis of MEF2C using anti-MEF2C antibody. MEF2C was detected in paraffin-embedded section of rat brain tissue.

IHC analysis of MEF2C using anti-MEF2C antibody. MEF2C was detected in paraffin-embedded section of mouse brain tissue.