MEF2B monoclonal antibody (M24), clone 4B5

• Catalog Number: orb2292605
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant MEF2B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4B5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
• NCBI: NP_005910.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

MEF2B monoclonal antibody (M24), clone 4B5. Western Blot analysis of MEF2B expression in human stomach.

Western Blot detection against Immunogen (33.44 KDa).