MCUR1 Antibody

• Catalog Number: orb527032
• Category: Antibodies
• Description: MCUR1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human MCUR1 (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 40 kDa
• UniProt ID: Q96AQ8
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Mitochondrial calcium uniporter regulator 1; MCU r
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB analysis of MCUR1 using anti-MCUR1 antibody.Lane 1:human HeLa cell.2:human MDA-MB-231 cell;3:human HL-60 cell;4:human MDA-MB-453 cell;5:human A431 cell;6:human Caco-2 cell;7:rat spleen tissue;8:mouse lung tissue;9:mouse Ana-1 cell.

IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human oesophagus squama cancer tissue.

IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human ovary cancer tissue.

IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human tonsil tissue.