You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb527032 |
---|---|
Category | Antibodies |
Description | MCUR1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human MCUR1 (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 40 kDa |
UniProt ID | Q96AQ8 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Mitochondrial calcium uniporter regulator 1; MCU r Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB analysis of MCUR1 using anti-MCUR1 antibody.Lane 1:human HeLa cell.2:human MDA-MB-231 cell;3:human HL-60 cell;4:human MDA-MB-453 cell;5:human A431 cell;6:human Caco-2 cell;7:rat spleen tissue;8:mouse lung tissue;9:mouse Ana-1 cell.
IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human oesophagus squama cancer tissue.
IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human ovary cancer tissue.
IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of MCUR1 using anti-MCUR1 antibody.MCUR1 was detected in paraffin-embedded section of human tonsil tissue.
IHC, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating