You have no items in your shopping cart.
Cart summary
Mcpt4 Protein, Mouse, Recombinant (His)
Catalog Number: orb1977141
| Catalog Number | orb1977141 |
|---|---|
| Category | Proteins |
| Description | Mcpt4 Protein, Mouse, Recombinant (His) is expressed in Yeast. |
| Tag | N-6xHis |
| Purity | 90.00% |
| Protein Sequence | IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE |
| UniProt ID | P21812 |
| MW | 27.1 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Mouse |
| Biological Activity | Mcpt4 Protein, Mouse, Recombinant (His) is expressed in Yeast. |
| Expression Region | 21-246 aa |
| Storage | -20°C |
| Note | For research use only |
Mcpt4 Protein, Mouse, Recombinant (E. coli, His) [orb1977142]
90.00%
29.1 kDa (predicted)
1 mg, 100 μg, 20 μg
