Cart summary

You have no items in your shopping cart.

    MBD1 Antibody

    Catalog Number: orb669188

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb669188
    CategoryAntibodies
    DescriptionMBD1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human MBD1 (DLTLFDFKQGILCYPAPKAHPVAVASKKRK).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.25-0.5μg/ml, Human, Mouse, Rat Flow Cytometry, 1-3μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW67 kDa
    UniProt IDQ9UIS9
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    MBD1 Antibody

    Western blot analysis of MBD1 using anti-MBD1 antibody (orb669188). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Jurkat whole cell lysates, Lane 2: human HELA whole cell lysates, Lane 3: human HEK293 whole cell lysates, Lane 4: human HEPG2 whole cell lysates, Lane 5: human U20S whole cell lysates, Lane 6: rat thymus tissue lysates, Lane 7: mouse thymus tissue lysates, Lane 8: mouse SP2/0 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MBD1 antigen affinity purified polyclonal antibody (Catalog # orb669188) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for MBD1 at approximately 67KD. The expected band size for MBD1 is at 67KD.

    MBD1 Antibody

    Flow Cytometry analysis of A549 cells using anti-MBD1 antibody (orb669188). Overlay histogram showing A549 cells stained with orb669188 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (orb669188, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    MBD1 Antibody

    Flow Cytometry analysis of U20S cells using anti-MBD1 antibody (orb669188). Overlay histogram showing U20S cells stained with orb669188 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (orb669188, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    • ATF7IP2 Antibody [orb1270775]

      FC,  IHC-P,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      400 μl
    • Anti-ATF7IP2 Antibody [orb1880963]

      FC,  IH,  WB

      Human, Mouse

      Polyclonal

      Unconjugated

      50 μl, 100 μl, 200 μl
    • MBD1 antibody [orb401116]

      ELISA,  IF,  IHC

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 50 μg
    • MBD1 antibody [orb78199]

      ELISA,  IHC,  WB

      Mouse, Rat

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μg
    • MCAF Antibody [orb1530596]

      IHC,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      10 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars