You have no items in your shopping cart.
Cart summary
MASTL Peptide - C-terminal region
Catalog Number: orb2009992
| Catalog Number | orb2009992 |
|---|---|
| Category | Proteins |
| Description | MASTL Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL |
| UniProt ID | Q96GX5 |
| MW | 97kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | FLJ14813, RP11-85G18.2, THC2, GW, GWL, hGWL, MAST- Read more... |
| Note | For research use only |
| NCBI | NP_116233 |
| Expiration Date | 6 months from date of receipt. |
