You have no items in your shopping cart.
Cart summary
MARK2 Peptide - C-terminal region
Catalog Number: orb2002221
| Catalog Number | orb2002221 |
|---|---|
| Category | Proteins |
| Description | MARK2 Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: IPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKT |
| UniProt ID | Q7KZI7 |
| MW | 86kDa |
| Application notes | This is a synthetic peptide designed for use in combination with MARK2 Rabbit Polyclonal Antibody (orb588135). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | MARK2 {ECO:0000312|EMBL:AAH08771.2,,EMK1 |
| Note | For research use only |
