Cart summary

You have no items in your shopping cart.

    MAPKAPK5 Antibody (Phospho-Thr182) : Biotin

    MAPKAPK5 Antibody (Phospho-Thr182) : Biotin

    Catalog Number: orb2070934

    DispatchUsually dispatched within 5-10 working days
    $ 578.00
    Catalog Numberorb2070934
    CategoryAntibodies
    DescriptionMAPKAPK5 Antibody (Phospho-Thr182) : Biotin
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsELISA, IHC, WB
    ImmunogenThe antiserum was produced against synthesized peptide derived from human MAPKAPK5 around the phosphorylation site of Thr182.
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationBiotin
    MW54 kDa
    UniProt IDQ8IW41
    Protein SequenceSynthetic peptide located within the following region: DLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEA
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesMK5, MK-5, PRAK, MAPKAP-K5
    Read more...
    NoteFor research use only
    Application notesApplication Info: WB: 1:500~1:1000IHC: 1:50~1:100ELISA: 1:1000
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars