MAPK6 monoclonal antibody (M02), clone 4C11

• Catalog Number: orb2292341
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MAPK6.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: MAPK6 (AAH35492, 612 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHLN
• Tested applications: ELISA, IF, WB
• Clone Number: 4C11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH35492
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MAPK6 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MAPK6 on HeLa cell. [antibody concentration 10 ug/ml]

MAPK6 monoclonal antibody (M02), clone 4C11 Western Blot analysis of MAPK6 expression in Jurkat.

MAPK6 monoclonal antibody (M02), clone 4C11. Western Blot analysis of MAPK6 expression in PC-12.

MAPK6 monoclonal antibody (M02), clone 4C11. Western Blot analysis of MAPK6 expression in Raw 264.7.

Western Blot detection against Immunogen (37.84 KDa).