MAPK14 monoclonal antibody (M01), clone 3D5

• Catalog Number: orb2294086
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MAPK14.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D5
• Tested applications: ELISA, IHC-P, IP, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: MAPK14 (AAH31574, 260 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
• NCBI: AAH31574
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to MAPK14 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml].

Immunoprecipitation of MAPK14 transfected lysate using anti-MAPK14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAPK14 monoclonal antibody.

MAPK14 monoclonal antibody (M01), clone 3D5 Western Blot analysis of MAPK14 expression in C32.

Proximity Ligation Analysis of protein-protein interactions between AKT1 and MAPK14. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-MAPK14 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Analysis of protein-protein interactions between AKT1 and MAPK14. Huh7 cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-MAPK14 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of MAPK14 expression in transfected 293T cell line by MAPK14 monoclonal antibody (M01), clone 3D5. Lane 1: MAPK14 transfected lysate(41.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).