You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976925 |
---|---|
Category | Proteins |
Description | MAP_1030 Protein, Mycobacterium paratuberculosis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.8 kDa and the accession number is P62039. |
Tag | N-6xHis |
Purity | 98.00% |
MW | 28.8 kDa (predicted) |
UniProt ID | P62039 |
Protein Sequence | MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE |
Expression System | P. pastoris (Yeast) |
Biological Origin | Mycobacterium paratuberculosis |
Biological Activity | MAP_1030 Protein, Mycobacterium paratuberculosis, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.8 kDa and the accession number is P62039. |
Expression Region | 1-250 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |
98.00% | |
32.8 kDa (predicted) |