MAP2K1 monoclonal antibody (M01), clone 1B5

• Catalog Number: orb2292339
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MAP2K1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: MAP2K1 (NP_002746, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
• NCBI: NP_002746
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of MAP2K1 expression in transfected 293T cell line by MAP2K1 monoclonal antibody (M01), clone 1B5. Lane 1: MAP2K1 transfected lysate (Predicted MW: 43.439 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).