MAGI1 monoclonal antibody (M03), clone 7B4

• Catalog Number: orb2291750
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MAGI1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7B4
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Rat
• Isotype: IgG1 Kappa
• Immunogen: MAGI1 (NP_004733, 761 a.a. ~ 859 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
• NCBI: NP_004733
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MAGI1 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MAGI1 on HeLa cell. [antibody concentration 10 ug/ml]

MAGI1 monoclonal antibody (M03), clone 7B4 Western Blot analysis of MAGI1 expression in PC-12.

Western Blot detection against Immunogen (36.63 KDa).