MAD2L1 monoclonal antibody (M01), clone 2E2-1D6

• Catalog Number: orb2292628
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant MAD2L1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E2-1D6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: MAD2L1 (AAH00356, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
• NCBI: AAH00356
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MAD2L1 is approximately 0.03 ng/ml as a capture antibody.

MAD2L1 monoclonal antibody (M01), clone 2E2-1D6 Western Blot analysis of MAD2L1 expression in HeLa.

Western Blot analysis of MAD2L1 expression in transfected 293T cell line by MAD2L1 monoclonal antibody (M01), clone 2E2-1D6. Lane 1: MAD2L1 transfected lysate (23.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (48.29 KDa).