You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292628 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant MAD2L1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | MAD2L1 (AAH00356, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND |
Tested applications | ELISA, WB |
Clone Number | 2E2-1D6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH00356 |
Detection limit for recombinant GST tagged MAD2L1 is approximately 0.03 ng/ml as a capture antibody.
MAD2L1 monoclonal antibody (M01), clone 2E2-1D6 Western Blot analysis of MAD2L1 expression in HeLa.
Western Blot analysis of MAD2L1 expression in transfected 293T cell line by MAD2L1 monoclonal antibody (M01), clone 2E2-1D6. Lane 1: MAD2L1 transfected lysate (23.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (48.29 KDa).