Cart summary

You have no items in your shopping cart.

M1AP Rabbit Polyclonal Antibody (HRP)

M1AP Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2108945

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108945
CategoryAntibodies
DescriptionM1AP Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Human, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of HUMAN M1AP
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW40kDa
UniProt IDQ8TC57
Protein SequenceSynthetic peptide located within the following region: EGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDL
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesD6Mm5e, SPGF48, C2orf65, SPATA37
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.