LZTFL1 monoclonal antibody (M01), clone 7F6

• Catalog Number: orb2291090
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant LZTFL1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7F6
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: LZTFL1 (NP_065080, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
• NCBI: NP_065080
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged LZTFL1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to LZTFL1 on HeLa cell. [antibody concentration 25 ug/ml]

Immunoperoxidase of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

LZTFL1 monoclonal antibody (M01), clone 7F6 Western Blot analysis of LZTFL1 expression in HeLa.

Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M01), clone 7F6. Lane 1: LZTFL1 transfected lysate (34.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).