LYPLA1 monoclonal antibody (M05), clone 3D5

• Catalog Number: orb2291571
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant LYPLA1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D5
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: LYPLA1 (AAH08652.1, 66 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS
• NCBI: AAH08652.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged LYPLA1 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to LYPLA1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of LYPLA1 expression in transfected 293T cell line by LYPLA1 monoclonal antibody (M05), clone 3D5. Lane 1: LYPLA1 transfected lysate (24.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.2 KDa).