Cart summary

You have no items in your shopping cart.

LYL1 Peptide - C-terminal region

LYL1 Peptide - C-terminal region

Catalog Number: orb2003391

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2003391
CategoryProteins
DescriptionLYL1 Peptide - C-terminal region
Tested applicationsWB
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW30kDa
UniProt IDP12980
Protein SequenceSynthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
NCBINP_005574
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesbHLHa18
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with LYL1 Rabbit Polyclonal Antibody (orb573700). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.