Cart summary

You have no items in your shopping cart.

LY6G5B Rabbit Polyclonal Antibody (HRP)

LY6G5B Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2094932

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2094932
CategoryAntibodies
DescriptionLY6G5B Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityCanine, Equine, Human, Porcine
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein SequenceSynthetic peptide located within the following region: IYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSS
UniProt IDQ8NDX9
MW22kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesG5b, C6orf19
NoteFor research use only
NCBINP_067044
Expiration Date12 months from date of receipt.