You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977153 |
---|---|
Category | Proteins |
Description | LY6E Protein, Mouse, Recombinant (His & SUMO) is expressed in yeast with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is Q64253. |
Tag | N-6xHis-SUMO |
Purity | 98.00% |
MW | 24.8 kDa (predicted) |
UniProt ID | Q64253 |
Protein Sequence | LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA |
Expression System | P. pastoris (Yeast) |
Biological Origin | Mouse |
Biological Activity | LY6E Protein, Mouse, Recombinant (His & SUMO) is expressed in yeast with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is Q64253. |
Expression Region | 27-108 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |