C1orf190 Rabbit Polyclonal Antibody

• Catalog Number: orb583055
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C1orf190
• Target: LURAP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf190
• Protein Sequence: Synthetic peptide located within the following region: SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL
• UniProt ID: Q96LR2
• MW: 26kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: LRP35A, LRAP35a, C1orf190
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_001013633
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-C1orf190 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.