You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331272 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LTB4-R2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse, Porcine, Rat |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38kDa |
Target | LTB4R2 |
UniProt ID | Q5KU28 |
Protein Sequence | Synthetic peptide located within the following region: VNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRTTPQ |
NCBI | NP_001158164 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti-LTB4 R 2 antibody, anti-LTB4 R2 antibody, ant Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of 721_B Whole Cell tissue using LTB4R2 antibody
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating