LRRC8A monoclonal antibody (M04), clone 8H9

• Catalog Number: orb2290983
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant LRRC8A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 8H9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: LRRC8A (NP_062540.2, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
• NCBI: NP_062540.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

LRRC8A monoclonal antibody (M04), clone 8H9. Western Blot analysis of LRRC8A expression in A-431.

Western Blot detection against Immunogen (36.74 KDa).