You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb865702 |
---|---|
Category | Antibodies |
Description | LPO Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IF, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human LPO (MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.25-0.5 μg/ml, Human Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 80 kDa |
UniProt ID | P22079 |
Storage | At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of LPO using anti-LPO antibody (orb865702). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions. Lane 1: human Caco-2 whole cell lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-LPO antigen affinity purified polyclonal antibody (Catalog # orb865702) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for LPO at approximately 80 kDa. The expected band size for LPO is at 80 kDa.
IF analysis of LPO using anti-LPO antibody (orb865702). LPO was detected in an immunocytochemical section of Caco-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (orb90553) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 μg/mL rabbit anti-LPO Antibody (orb865702) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
ELISA, WB | |
Bovine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating