Cart summary

You have no items in your shopping cart.

    LPO Antibody

    Catalog Number: orb865702

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb865702
    CategoryAntibodies
    DescriptionLPO Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsICC, IF, WB
    ReactivityHuman
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human LPO (MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.25-0.5 μg/ml, Human Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW80 kDa
    UniProt IDP22079
    StorageAt -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Expiration Date12 months from date of receipt.
    LPO Antibody

    Western blot analysis of LPO using anti-LPO antibody (orb865702). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions. Lane 1: human Caco-2 whole cell lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-LPO antigen affinity purified polyclonal antibody (Catalog # orb865702) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for LPO at approximately 80 kDa. The expected band size for LPO is at 80 kDa.

    LPO Antibody

    IF analysis of LPO using anti-LPO antibody (orb865702). LPO was detected in an immunocytochemical section of Caco-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (orb90553) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 μg/mL rabbit anti-LPO Antibody (orb865702) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

    • LPO antibody [orb422827]

      ELISA,  IHC,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 50 μg
    • LPO antibody [orb667188]

      WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • LPO antibody [orb395284]

      ELISA,  IHC,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      100 μg
    • Lactoperoxidase antibody [orb19853]

      ELISA,  WB

      Bovine, Human, Mouse, Porcine, Rat

      Goat

      Polyclonal

      Unconjugated

      100 μg
    • Human LPO ELISA Kit [orb775793]

      Human

      0.16-10 ng/mL

      0.056 ng/mL

      48 Test, 24 t, 96 Test
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars