LONRF2 Rabbit Polyclonal Antibody

• Catalog Number: orb325083
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LONRF2
• Target: LONRF2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LONRF2
• Protein Sequence: Synthetic peptide located within the following region: FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR
• UniProt ID: Q1L5Z9
• MW: 84kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ45273 antibody, anti MGC126711 antibody, a
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_940863

WB Suggested Anti-LONRF2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human heart.