Cart summary

You have no items in your shopping cart.

    LOC684800 antibody

    Catalog Number: orb326090

    DispatchUsually dispatched within 1 - 2 weeks
    $ 609.00
    Catalog Numberorb326090
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to LOC684800
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityBovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
    ReactivityCanine, Human, Mouse, Porcine, Rat, Zebrafish
    ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW50kDa
    TargetSMAP1
    Protein SequenceSynthetic peptide located within the following region: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV
    NCBIXP_002727223
    StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesanti LOC684800 antibody
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    LOC684800 antibody

    Western blot analysis of rat Heart tissue using LOC684800 antibody

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars