LMO2 Antibody

• Catalog Number: orb412986
• Category: Antibodies
• Description: LMO2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human LMO2 (QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot,0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 23 kDa
• UniProt ID: P25791
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Rhombotin-2; Cysteine-rich protein TTG-2; LIM doma
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of LMO2 using anti-LMO2 antibody.Lane 1:rat C6 cell;2:mouse Neuro-2a cell.

WB analysis of LMO2 using anti-LMO2 antibody.Lane 1:human placenta tissue;2:human SMMC-7721 cell;3:human A375 cell;4:human A431 cell.