You have no items in your shopping cart.
Cart summary
LIPA Protein, Human, Recombinant (His)
Catalog Number: orb1978290
| Catalog Number | orb1978290 |
|---|---|
| Category | Proteins |
| Description | Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol. LIPA Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 45.0 kDa and the accession number is P38571. |
| Tag | N-6xHis |
| Purity | 90.00% |
| MW | 45.0 kDa (predicted) |
| UniProt ID | P38571 |
| Protein Sequence | SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Catalyzes the deacylation of triacylglyceryl and cholesteryl ester core lipids of endocytosed low density lipoproteins to generate free fatty acids and cholesterol. LIPA Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 45.0 kDa and the accession number is P38571. |
| Expression Region | 22-399 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
