You have no items in your shopping cart.
Cart summary
LIN28A Protein, Human, Recombinant (His & SUMO)
Catalog Number: orb1977978
| Catalog Number | orb1977978 |
|---|---|
| Category | Proteins |
| Description | LIN28A Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 35.7 kDa and the accession number is Q9H9Z2. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 35.7 kDa (predicted) |
| UniProt ID | Q9H9Z2 |
| Protein Sequence | MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | LIN28A Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 35.7 kDa and the accession number is Q9H9Z2. |
| Expression Region | 1-209 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
