Cart summary

You have no items in your shopping cart.

    LILRA4 Antibody : FITC

    LILRA4 Antibody : FITC

    Catalog Number: orb2070741

    DispatchUsually dispatched within 5-10 working days
    $ 578.00
    Catalog Numberorb2070741
    CategoryAntibodies
    DescriptionLILRA4 Antibody : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsELISA, WB
    ImmunogenThe antiserum was produced against synthesized peptide derived from the Internal region of human LILRA4.
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW55 kDa
    UniProt IDP59901
    Protein SequenceSynthetic peptide located within the following region: GTYRCYGSRSSNPYLLSHPSEPLELVVSGATETLNPAQKKSDSKTAPHLQ
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesILT7, CD85g
    Read more...
    NoteFor research use only
    Application notesApplication Info: WB: 1:500~1:1000ELISA: 1:10000
    Expiration Date12 months from date of receipt.
    • LILRA4 antibody (FITC) [orb355437]

      Human

      Rabbit

      Polyclonal

      FITC

      100 μg, 50 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars