You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291460 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant LILRA3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | LILRA3 (AAH28208.1, 1 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE |
Tested applications | ELISA, WB |
Clone Number | 2E9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH28208.1 |
Western Blot analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9. Lane 1: LILRA3 transfected lysate(50.485 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (74.03 KDa).