You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292655 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human LGALS3 protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | LGALS3 (AAH53667.1, 1 a.a. ~ 250 a.a) full-length human protein. |
Protein Sequence | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH53667.1 |
LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in Hela S3 NE.
LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in human colon.
LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in human stomach.
LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in mouse brain.
LGALS3 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS3 expression in Raw 264.7.
Western Blot analysis of LGALS3 expression in transfected 293T cell line by LGALS3 MaxPab polyclonal antibody. Lane 1: LGALS3 transfected lysate (26.20 KDa). Lane 2: Non-transfected lysate.