You have no items in your shopping cart.
Cart summary
Leukotoxin Protein, Aggregatibacter actinomycetemcomitans, Recombinant (His)
Catalog Number: orb1979873
| Catalog Number | orb1979873 |
|---|---|
| Category | Proteins |
| Description | Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media. Leukotoxin Protein, Aggregatibacter actinomycetemcomitans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 38.3 kDa and the accession number is P16462. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 38.3 kDa (predicted) |
| UniProt ID | P16462 |
| Protein Sequence | IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNKKTISPQELAGLIKNKGKSSSLMSSSRSSSMLTQKSGLSNDISRIISATSGFGSSGKALSASPLQTNNNFNSYANSLATTA |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Aggregatibacter actinomycetemcomitans |
| Biological Activity | Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media. Leukotoxin Protein, Aggregatibacter actinomycetemcomitans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 38.3 kDa and the accession number is P16462. |
| Expression Region | 721-1055 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
