You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1979873 |
---|---|
Category | Proteins |
Description | Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media. Leukotoxin Protein, Aggregatibacter actinomycetemcomitans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 38.3 kDa and the accession number is P16462. |
Tag | N-6xHis |
Purity | 98.00% |
MW | 38.3 kDa (predicted) |
UniProt ID | P16462 |
Protein Sequence | IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNKKTISPQELAGLIKNKGKSSSLMSSSRSSSMLTQKSGLSNDISRIISATSGFGSSGKALSASPLQTNNNFNSYANSLATTA |
Expression System | P. pastoris (Yeast) |
Biological Origin | Aggregatibacter actinomycetemcomitans |
Biological Activity | Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media. Leukotoxin Protein, Aggregatibacter actinomycetemcomitans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 38.3 kDa and the accession number is P16462. |
Expression Region | 721-1055 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |