You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389491 |
---|---|
Category | Antibodies |
Description | Leptin Receptor/LEPR Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA, IHC |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eig |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat ELISA , 0.1-0.5μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 132494 MW |
UniProt ID | P48357 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Leptin receptor;LEP-R;HuB219;OB receptor;OB-R;CD29 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
IHC analysis of Leptin Receptor/LEPR using anti-Leptin Receptor/LEPR antibody. Leptin Receptor/LEPR was detected in paraffin-embedded section of mouse kidney tissue.
IHC analysis of Leptin Receptor/LEPR using anti-Leptin Receptor/LEPR antibody. Leptin Receptor/LEPR was detected in paraffin-embedded section of rat lung tissue.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
FC, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating