You have no items in your shopping cart.
Cart summary
LEB6 Protein, Vicia faba, Recombinant (His)
Catalog Number: orb1976215
| Catalog Number | orb1976215 |
|---|---|
| Category | Proteins |
| Description | This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals. LEB6 Protein, Vicia faba, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 19.0 kDa and the accession number is P16079. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 19.0 kDa (predicted) |
| UniProt ID | P16079 |
| Protein Sequence | GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Vicia faba |
| Biological Activity | This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals. LEB6 Protein, Vicia faba, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 19.0 kDa and the accession number is P16079. |
| Expression Region | 1-148 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
