LDLRAP1 monoclonal antibody (M01), clone 4G4-D5

• Catalog Number: orb2291278
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant LDLRAP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G4-D5
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: LDLRAP1 (AAH29770, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF
• NCBI: AAH29770
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged LDLRAP1 is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to LDLRAP1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to LDLRAP1 on formalin-fixed paraffin-embedded human maligant fibrous histiocytoma tissue. [antibody concentration 2 ug/ml]

LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 Western Blot analysis of LDLRAP1 expression in Hela S3 NE.

Western Blot analysis of LDLRAP1 expression in transfected 293T cell line by LDLRAP1 monoclonal antibody (M01), clone 4G4-D5. Lane 1: LDLRAP1 transfected lysate(29 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (54.67 KDa).