LASS6 monoclonal antibody (M01), clone 5H7

• Catalog Number: orb2290586
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant LASS6.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 5H7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_982288

Detection limit for recombinant GST tagged LASS6 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to LASS6 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

LASS6 monoclonal antibody (M01), clone 5H7 Western Blot analysis of LASS6 expression in HeLa.

Western Blot detection against Immunogen (33.44 KDa).