You have no items in your shopping cart.
Cart summary
LASP1 Protein, Human, Recombinant (E. coli, His)
Catalog Number: orb2816216
| Catalog Number | orb2816216 |
|---|---|
| Category | Proteins |
| Description | LASP1 Protein, Human, Recombinant (E. coli, His) is expressed in E. coli with C-6xHis. The accession number is Q14847. |
| Tag | C-6xHis |
| MW | 36.6 kDa (Predicted) |
| UniProt ID | Q14847 |
| Protein Sequence | MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 1-261 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
