You have no items in your shopping cart.
Cart summary
Lake Victoria marburgvirus (MARV) (strain Musoke-80) VP35 Protein (His)
Catalog Number: orb1977537
| Catalog Number | orb1977537 |
|---|---|
| Category | Proteins |
| Description | Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 40.2 kDa (predicted) |
| UniProt ID | P35259 |
| Protein Sequence | MWDSSYMQQVSEGLMTGKVPIDQVFGANPLEKLYKRRKPKGTVGLQCSPCLMSKATSTDDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTMVKNATTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPSQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI |
| Expression System | E. coli |
| Biological Origin | MARV |
| Biological Activity | Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling. |
| Expression Region | 1-329 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
