KSR2 monoclonal antibody (M08), clone 1G4

• Catalog Number: orb2290577
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant KSR2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: KSR2 (NP_775869, 411 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PAPPLPPSATPPSPLHPSPQCTRQQKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEV
• NCBI: NP_775869
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged KSR2 is approximately 0.03 ng/ml as a capture antibody.

KSR2 monoclonal antibody (M08), clone 1G4. Western Blot analysis of KSR2 expression in A-431.

Western Blot analysis of KSR2 expression in transfected 293T cell line by KSR2 monoclonal antibody (M08), clone 1G4. Lane 1: KSR2 transfected lysate (Predicted MW: 93.6 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of KSR2 over-expressed 293 cell line, cotransfected with KSR2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KSR2 monoclonal antibody (M08) clone 1G4 (Cat # orb2290577). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.53 KDa).