KRAS monoclonal antibody (M02A), clone 4F3

• Catalog Number: orb2292673
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant KRAS.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4F3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
• NCBI: NP_004976
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

KRAS monoclonal antibody (M02A), clone 4F3 Western Blot analysis of KRAS expression in HeLa.

Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M02A), clone 4F3. Lane 1: KRAS transfected lysate (21 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).