KRAS monoclonal antibody (M02A), clone 4F3

• Catalog Number: orb2292673
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant KRAS.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In ascites fluid
• Immunogen: KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
• Tested applications: ELISA, WB
• Clone Number: 4F3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004976

KRAS monoclonal antibody (M02A), clone 4F3 Western Blot analysis of KRAS expression in HeLa.

Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M02A), clone 4F3. Lane 1: KRAS transfected lysate (21 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).