You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292675 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant KPNA5. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | KPNA5 (AAH47409.1, 1 a.a. ~ 539 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL |
Tested applications | ELISA, WB |
Clone Number | 1D2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH47409.1 |
Detection limit for recombinant GST tagged KPNA5 is approximately 3 ng/ml as a capture antibody.
KPNA5 monoclonal antibody (M01), clone 1D2 Western Blot analysis of KPNA5 expression in HepG2.
Western Blot analysis of KPNA5 expression in transfected 293T cell line by KPNA5 monoclonal antibody (M01), clone 1D2. Lane 1: KPNA5 transfected lysate (60.7 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of KPNA5 over-expressed 293 cell line, cotransfected with KPNA5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KPNA5 monoclonal antibody (M01), clone 1D2 (Cat # orb2292675). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (85.03 KDa).